Gene Mb3232c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3232c, -, len: 285 aa. Equivalent to Rv3207c,len: 285 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 285 aa overlap). Hypothetical protein,highly similar but shorter (57 aa) to Q9CCG9|ML0816 HYPOTHETICAL PROTEIN from Mycobacterium leprae (341 aa),FASTA scores: opt: 1676, E(): 9.7e-96, (81.0% identity in 284 aa overlap). Also similar to C-terminus of Q9FBI6|SCP8.36 HYPOTHETICAL PROTEIN from Streptomyces coelicolor (559 aa), FASTA scores: opt: 426, E(): 8.4e-19,(37.35% identity in 281 aa overlap); and similar to other hypothetical proteins (generally membrane proteins) e.g. Q9K456|SC2H12.28C PUTATIVE MEMBRANE PROTEIN from Streptomyces coelicolor (314 aa), FASTA scores: opt: 341,E(): 8.8e-14, (29.75% identity in 296 aa overlap). Contains neutral zinc metallopeptidases, zinc-binding region signature (PS00142). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3538342 | 3539199 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3232c|Mb3232c
MSTYGWRAYALPVLMVLTTVVVYQTVTGTSTPRPAAAQTVRDSPAIGVVGTAILDAPPRGLAVFDANLPAGTLPDGGPFTEAGDKTWRVVPGTTPQVGQGTVKVFRYTVEIENGLDPTMYGGDNAFAQMVDQTLTNPKGWTHNPQFAFVRIDSGKPNFRISLVSPTTVRGGCGYEFRLETSCYNPSFGGMDRQSRVFINEARWVRGAVPFEGDVGSYRQYVINHEVGHAIGYLRHEPCDQQGGLAPVMMQQTFSTSNDDAAKFDPDFVKADGKTCRFNPWPYPIP
Bibliography
No article yet recorded
