Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductProbable transcriptional regulatory protein (probably TetR-family)
CommentsRv3208, (MTCY07D11.18c), len: 228 aa. Probable transcriptional regulator, TetR family, equivalent to Q9CCH0|ML0815 putative TetR-family transcriptional regulator from Mycobacterium leprae (228 aa), FASTA scores: opt: 1248, E(): 1.4e-74, (82.4% identity in 227 aa overlap). Also highly similar to Q9FBI8|SCP8.33c putative TetR-family transcriptional regulator from Streptomyces coelicolor (213 aa), FASTA scores: opt: 629, E(): 4e-34, (45.8% identity in 203 aa overlap); Q9KIL9|F58R F58R (fragment) from Streptomyces coelicolor A3(2) (149 aa), FASTA scores: opt: 497, E(): 1.3e-25, (50.35% identity in 147 aa overlap); Q9K3T5|SCE66.08 putative TetR-family transcriptional regulator from Streptomyces coelicolor (225 aa), FASTA scores: opt: 344, E(): 1.8e-15, (31.15% identity in 212 aa overlap); Q9RYK4|DRA0308 transcriptional regulator, TetR family from Deinococcus radiodurans (239 aa), FASTA scores: opt: 290, E(): 6.5e-12, (30.5% identity in 223 aa overlap); etc. And also similar to Mycobacterium tuberculosis proteins P96381|Rv1019|MTCY10G2.30c hypothetical 21.7 KDA protein (197 aa), FASTA scores: opt: 356, E(): 2.7e-16, (34.4% identity in 189 aa overlap); MTV034_4; MTY07A7A_3; MTV032_1; MTCY07A7_12; etc. Contains probable helix-turn-helix motif at aa 60-81 (Score 1517, +4.35 SD). Similar to the TetR/AcrR family of transcriptional regulators.
Functional categoryRegulatory proteins
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35850043585690+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3208|Rv3208
MSDLAKTAQRRALRSSGSARPDEDVPAPNRRGNRLPRDERRGQLLVVASDVFVDRGYHAAGMDEIADRAGVSKPVLYQHFSSKLELYLAVLHRHVENLVSGVHQALSTTTDNRQRLHVAVQAFFDFIEHDSQGYRLIFENDFVTEPEVAAQVRVATESCIDAVFALISADSGLDPHRARMIAVGLVGMSVDCARYWLDADKPISKSDAVEGTVQFAWGGLSHVPLTRS