Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but possibly involved in regulation of partitioning.
ProductPossible SOJ/para-related protein
CommentsRv3213c, (MTCY07D11.13), len: 266 aa. Possible soj/parA-related protein, very similar in particular to Soj/ParA proteins (and relatives) from Bacillus subtilis that inhibit the initiation of sporulation by preventing phosphorylation of Spo0A (see Quisel & Grossman 2000) e.g. Q9S228|SCI51.12c from Streptomyces coelicolor (340 aa), FASTA scores: opt: 746, E(): 1.6e-40, (48.2% identity in 249 aa overlap); Q9HT11|SOJ|PA5563 from Pseudomonas aeruginosa (262 aa), FASTA scores: opt: 649, E(): 2.1e-34, (42.2% identity in 256 aa overlap); Q9PB62|XF2282 from Xylella fastidiosa (264 aa), FASTA scores: opt: 624, E(): 8.3e-33, (42.25% identity in 251 aa overlap); Q9K5N0|SOJ_BACHD|SOJ|BH4058 from Bacillus halodurans (253 aa), FASTA scores: opt: 621, E(): 1.2e-32, (41.55% identity in 248 aa overlap); P37522|SOJ_BACSU (253 aa), FASTA scores: opt: 620, E(): 1.4e-32, (41.65% identity in 245; etc. Also similar to various mycobacterial proteins: U00021_10 from Mycobacterium leprae, MTCI125_29 from Mycobacterium tuberculosis, MLCB1351_6 from Mycobacterium leprae, MTV028_9c|Rv3918c|para probable chromosome partitioning protein from Mycobacterium tuberculosis, MSGDNAB_18 from Mycobacterium leprae. Seems to belong to the para family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see Jungblut et al., 1999). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain but mutant is more virulent in SCID mice (see McAdam et al., 2002).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35906923591492-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3213c|Rv3213c
MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADKAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLDVADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL
      
Bibliography