Gene Rv3213c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but possibly involved in regulation of partitioning. |
| Product | Possible SOJ/para-related protein |
| Comments | Rv3213c, (MTCY07D11.13), len: 266 aa. Possible soj/parA-related protein, very similar in particular to Soj/ParA proteins (and relatives) from Bacillus subtilis that inhibit the initiation of sporulation by preventing phosphorylation of Spo0A (see Quisel & Grossman 2000) e.g. Q9S228|SCI51.12c from Streptomyces coelicolor (340 aa), FASTA scores: opt: 746, E(): 1.6e-40, (48.2% identity in 249 aa overlap); Q9HT11|SOJ|PA5563 from Pseudomonas aeruginosa (262 aa), FASTA scores: opt: 649, E(): 2.1e-34, (42.2% identity in 256 aa overlap); Q9PB62|XF2282 from Xylella fastidiosa (264 aa), FASTA scores: opt: 624, E(): 8.3e-33, (42.25% identity in 251 aa overlap); Q9K5N0|SOJ_BACHD|SOJ|BH4058 from Bacillus halodurans (253 aa), FASTA scores: opt: 621, E(): 1.2e-32, (41.55% identity in 248 aa overlap); P37522|SOJ_BACSU (253 aa), FASTA scores: opt: 620, E(): 1.4e-32, (41.65% identity in 245; etc. Also similar to various mycobacterial proteins: U00021_10 from Mycobacterium leprae, MTCI125_29 from Mycobacterium tuberculosis, MLCB1351_6 from Mycobacterium leprae, MTV028_9c|Rv3918c|para probable chromosome partitioning protein from Mycobacterium tuberculosis, MSGDNAB_18 from Mycobacterium leprae. Seems to belong to the para family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see Jungblut et al., 1999). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain but mutant is more virulent in SCID mice (see McAdam et al., 2002). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3590692 | 3591492 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3213c|Rv3213c
MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADKAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLDVADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL
Bibliography
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Quisel JD et al. [2000]. Control of sporulation gene expression in Bacillus subtilis by the chromosome partitioning proteins Soj (ParA) and Spo0J (ParB). Homolog Secondary
- McAdam RA, Quan S, Smith DA, Bardarov S, Betts JC, Cook FC, Hooker EU, Lewis AP, Woollard P, Everett MJ, Lukey PT, Bancroft GJ, Jacobs Jr WR and Duncan K [2002]. Characterization of a Mycobacterium tuberculosis H37Rv transposon library reveals insertions in 351 ORFs and mutants with altered virulence. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
