Gene Mb3239c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE SOJ/PARA-RELATED PROTEIN |
| Comments | Mb3239c, -, len: 266 aa. Equivalent to Rv3213c,len: 266 aa, from Mycobacterium tuberculosis strain H37Rv,(99.624% identity in 266 aa overlap). Possible soj/parA-related protein, very similar in particular to Soj/ParA proteins (and relatives) from Bacillus subtilis that inhibit the initiation of sporulation by preventing phosphorylation of Spo0A (see first citation below for more information) e.g. Q9S228|SCI51.12c from Streptomyces coelicolor (340 aa), FASTA scores: opt: 746, E(): 1.6e-40,(48.2% identity in 249 aa overlap); Q9HT11|SOJ|PA5563 from Pseudomonas aeruginosa (262 aa), FASTA scores: opt: 649,E(): 2.1e-34, (42.2% identity in 256 aa overlap); Q9PB62|XF2282 from Xylella fastidiosa (264 aa), FASTA scores: opt: 624, E(): 8.3e-33, (42.25% identity in 251 aa overlap); Q9K5N0|SOJ_BACHD|SOJ|BH4058 from Bacillus halodurans (253 aa), FASTA scores: opt: 621, E(): 1.2e-32,(41.55% identity in 248 aa overlap); P37522|SOJ_BACSU (253 aa), FASTA scores: opt: 620, E(): 1.4e-32, (41.65% identity in 245; etc. Also similar to various mycobacterial proteins: U00021_10 from Mycobacterium leprae, MTCI125_29 from Mycobacterium tuberculosis,MLCB1351_6 from Mycobacterium leprae,MTV028_9c|Rv3918c|PARA PROBABLE CHROMOSOME PARTITIONING PROTEIN from Mycobacterium tuberculosis, MSGDNAB_18 from Mycobacterium leprae. SEEMS TO BELONG TO THE PARA FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3545235 | 3546035 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3239c|Mb3239c
MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLDVADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL
Bibliography
No article yet recorded