Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in glycolysis [catalytic activity: 1,3-diphosphoglycerate + 3-phosphoglycerate = 2,3-diphosphoglycerate + 3-phosphoglycerate].
ProductPossible phosphoglycerate mutase Gpm2 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM)
CommentsRv3214, (MTCY07D11.12c), len: 203 aa. Possible gpm2, phosphoglycerate mutase, similar to many mutases especially phosphoglycerate mutases e.g. Q9F3H5|2SCC13.14c putative mutase from Streptomyces coelicolor (198 aa), FASTA scores: opt: 487, E(): 4.4e-25, (42.25% identity in 194 aa overlap); BAB49378|MLL2186 probable phosphoglycerate mutase from Rhizobium loti (Mesorhizobium loti) (193 aa), FASTA scores: opt: 423, E(): 7e-21, (41.2% identity in 182 aa overlap); Q9RKV8|SC9G1.08c putative phosphatase from Streptomyces coelicolor (199 aa), FASTA scores: opt: 419, E(): 1.3e-20, (41.1% identity in 185 aa overlap); Q9RDL0|SCC123.14c putative phosphoglycerate mutase from Streptomyces coelicolor (223 aa), FASTA scores: opt: 240, E(): 8.8e-09, (36.9% identity in 168 aa overlap); Q9X194|TM1374 phosphoglycerate mutase from Thermotoga maritima (201 aa), FASTA scores: opt: 218, E(): 2.3e-07, (33.15% identity in 202 aa overlap); etc. But N-terminus also similar to Q9CCH5|ENTC|ML0808 putative isochorismate synthase from Mycobacterium leprae (577 aa), FASTA scores: opt: 346, E(): 2.1e-15, (55.05% identity in 109 aa overlap). N-terminus shows also some similarity with other M. tuberculosis proteins e.g. MTCY427.09c; MTCY20G9.15; MTCY428.28. Equivalent to AAK47652 from Mycobacterium tuberculosis strain CDC1551 (228 aa) but shorter 25 aa. Note that previously known as entD.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35916463592257+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3214|gpm2
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG