Gene Rv3214 (entD)
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Involved in glycolysis [catalytic activity: 1,3-diphosphoglycerate + 3-phosphoglycerate = 2,3-diphosphoglycerate + 3-phosphoglycerate]. | 
| Product | Possible phosphoglycerate mutase Gpm2 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) | 
| Comments | Rv3214, (MTCY07D11.12c), len: 203 aa. Possible gpm2, phosphoglycerate mutase, similar to many mutases especially phosphoglycerate mutases e.g. Q9F3H5|2SCC13.14c putative mutase from Streptomyces coelicolor (198 aa), FASTA scores: opt: 487, E(): 4.4e-25, (42.25% identity in 194 aa overlap); BAB49378|MLL2186 probable phosphoglycerate mutase from Rhizobium loti (Mesorhizobium loti) (193 aa), FASTA scores: opt: 423, E(): 7e-21, (41.2% identity in 182 aa overlap); Q9RKV8|SC9G1.08c putative phosphatase from Streptomyces coelicolor (199 aa), FASTA scores: opt: 419, E(): 1.3e-20, (41.1% identity in 185 aa overlap); Q9RDL0|SCC123.14c putative phosphoglycerate mutase from Streptomyces coelicolor (223 aa), FASTA scores: opt: 240, E(): 8.8e-09, (36.9% identity in 168 aa overlap); Q9X194|TM1374 phosphoglycerate mutase from Thermotoga maritima (201 aa), FASTA scores: opt: 218, E(): 2.3e-07, (33.15% identity in 202 aa overlap); etc. But N-terminus also similar to Q9CCH5|ENTC|ML0808 putative isochorismate synthase from Mycobacterium leprae (577 aa), FASTA scores: opt: 346, E(): 2.1e-15, (55.05% identity in 109 aa overlap). N-terminus shows also some similarity with other M. tuberculosis proteins e.g. MTCY427.09c; MTCY20G9.15; MTCY428.28. Equivalent to AAK47652 from Mycobacterium tuberculosis strain CDC1551 (228 aa) but shorter 25 aa. Note that previously known as entD. | 
| Functional category | Intermediary metabolism and respiration | 
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3591646 | 3592257 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv3214|gpm2
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant