Gene Mb3240
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2 (PHOSPHOGLYCEROMUTASE) (PGAM) (BPG-DEPENDENT PGAM) |
| Comments | Mb3240, gpm2, len: 203 aa. Equivalent to Rv3214,len: 203 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 203 aa overlap). Possible gpm2,phosphoglycerate mutase (EC 5.4.2.1), similar to many mutases especially phosphoglycerate mutases e.g. Q9F3H5|2SCC13.14c PUTATIVE MUTASE from Streptomyces coelicolor (198 aa), FASTA scores: opt: 487, E(): 4.4e-25,(42.25% identity in 194 aa overlap); BAB49378|MLL2186 PROBABLE PHOSPHOGLYCERATE MUTASE from Rhizobium loti (Mesorhizobium loti) (193 aa), FASTA scores: opt: 423,E(): 7e-21, (41.2% identity in 182 aa overlap); Q9RKV8|SC9G1.08c PUTATIVE PHOSPHATASE from Streptomyces coelicolor (199 aa), FASTA scores: opt: 419, E(): 1.3e-20,(41.1% identity in 185 aa overlap); Q9RDL0|SCC123.14c PUTATIVE PHOSPHOGLYCERATE MUTASE from Streptomyces coelicolor (223 aa), FASTA scores: opt: 240, E(): 8.8e-09,(36.9% identity in 168 aa overlap); Q9X194|TM1374 PHOSPHOGLYCERATE MUTASE from Thermotoga maritima (201 aa),FASTA scores: opt: 218, E(): 2.3e-07, (33.15% identity in 202 aa overlap); etc. But N-terminus also similar to Q9CCH5|ENTC|ML0808 PUTATIVE ISOCHORISMATE SYNTHASE from Mycobacterium leprae (577 aa), FASTA scores: opt: 346,E(): 2.1e-15, (55.05% identity in 109 aa overlap). N-terminus shows also some similarity with other M. tuberculosis proteins e.g. MTCY427.09c; MTCY20G9.15; MTCY428.28. Equivalent to AAK47652 from Mycobacterium tuberculosis strain CDC1551 (228 aa) but shorter 25 aa. Note that previously known as entD. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3546189 | 3546800 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3240|gpm2
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG
Bibliography
No article yet recorded