Gene Rv3221c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Biotinylated protein TB7.3 |
| Comments | Rv3221c, (MTCY07D11.05), len: 71 aa. TB7.3, Biotinylated protein (see citations below), equivalent (appears to have one additional residue) to Q9CCH9|ML0802|BTB7_MYCLE biotinylated protein TB7.3 homolog from Mycobacterium leprae (70 aa), FASTA scores: opt: 367, E(): 4e-18, (90.0% identity in 70 aa overlap); Q9XCD6|BTB7_MYCSM biotinylated protein TB7.3 homolog from Mycobacterium smegmatis (70 aa), FASTA scores: opt: 341, E(): 2.1e-16, (84.05% identity in 69 aa overlap). Similar to C-terminal part of various proteins e.g. Q9HPP8|ACC|VNG1532G biotin carboxylase from Halobacterium sp. strain NRC-1 (610 aa), FASTA scores: opt: 212, E(): 4e-07, (50.0% identity in 68 aa overlap); Q58628|PYCB_METJA|MJ1231 pyruvate carboxylase subunit B from Methanococcus jannaschii (567 aa), FASTA scores: opt: 192, E(): 7.8e-06, (44.8% identity in 58 aa overlap); Q9ZAA7|GCDC glutaconyl-CoA decarboxylase gamma subunit from Acidaminococcus fermentans (145 aa), FASTA scores: opt: 184, E(): 8.9e-06, (39.4% identity in 66 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Proteomics | The product of this CDS corresponds to spot TB7.3 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see citations below). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3597551 | 3597766 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3221c|TB7.3
MAEDVRAEIVASVLEVVVNEGDQIDKGDVVVLLESMKMEIPVLAEAAGTVSKVAVSVGDVIQAGDLIAVIS
Bibliography
- Skjot RL, Oettinger T, Rosenkrands I, Ravn P, Brock I, Jacobsen S and Andersen P [2000]. Comparative evaluation of low-molecular-mass proteins from Mycobacterium tuberculosis identifies members of the ESAT-6 family as immunodominant T-cell antigens. Proteomics
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant