Gene ML0802 (TB7.3, ML7.3)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable biotinylated protein homolog TB7.3 |
| Comments | ML0802, len: 71 aa. Probable biotinylated protein TB7.3 homolog, highly similar to Rv3221c|MTCY07d11.05|O05845|Z95120 TB7.3, Biotinylated protein from Mycobacterium tuberculosis (71 aa), fasta scores: E(): 6.2e-19, (90.1% identity in 71 aa) and Q9XCD6|BTB7_MYCSM Biotinylated protein TB7.3 homolog from M. smegmatis (70 aa), fasta scores: E(): 9.8e-18, (85.507% identity in 69 aa overlap). Also similar to the C-terminal half of O54030|AJ002015 mmdC methylmalonyl-CoA decarboxylase, gamma-subunit from Propionigenium modestum (134 aa), fasta scores: E(): 3.4e-06, (42.9% identity in 70 aa). Contains Pfam match to entry PF00364 biotin_lipoyl, Biotin-requiring enzymes. Contains PS00445 FGGY family of carbohydrate kinases signature 2. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 951840 | 952055 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0802|ML0802
MAEDVRAEIVASVLEVVVSEGDQIGKGDVLVLLESMKMEIPVLAGVAGIVSKVSVSVGDVIQAGDLIAVIS
Bibliography
No article yet recorded
