Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductBiotinylated protein TB7.3
CommentsRv3221c, (MTCY07D11.05), len: 71 aa. TB7.3, Biotinylated protein (see citations below), equivalent (appears to have one additional residue) to Q9CCH9|ML0802|BTB7_MYCLE biotinylated protein TB7.3 homolog from Mycobacterium leprae (70 aa), FASTA scores: opt: 367, E(): 4e-18, (90.0% identity in 70 aa overlap); Q9XCD6|BTB7_MYCSM biotinylated protein TB7.3 homolog from Mycobacterium smegmatis (70 aa), FASTA scores: opt: 341, E(): 2.1e-16, (84.05% identity in 69 aa overlap). Similar to C-terminal part of various proteins e.g. Q9HPP8|ACC|VNG1532G biotin carboxylase from Halobacterium sp. strain NRC-1 (610 aa), FASTA scores: opt: 212, E(): 4e-07, (50.0% identity in 68 aa overlap); Q58628|PYCB_METJA|MJ1231 pyruvate carboxylase subunit B from Methanococcus jannaschii (567 aa), FASTA scores: opt: 192, E(): 7.8e-06, (44.8% identity in 58 aa overlap); Q9ZAA7|GCDC glutaconyl-CoA decarboxylase gamma subunit from Acidaminococcus fermentans (145 aa), FASTA scores: opt: 184, E(): 8.9e-06, (39.4% identity in 66 aa overlap); etc.
Functional categoryLipid metabolism
ProteomicsThe product of this CDS corresponds to spot TB7.3 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see citations below).
Mutantnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35975513597766-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3221c|TB7.3
MAEDVRAEIVASVLEVVVNEGDQIDKGDVVVLLESMKMEIPVLAEAAGTVSKVAVSVGDVIQAGDLIAVIS
      
Bibliography