Gene Rv3222c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3222c, (MTCY07D11.04), len: 183 aa. Hypothetical protein, with some similarity to Q9SZD2|F19B15.50|AT4G29020 glycine-rich protein like from Arabidopsis thaliana (Mouse-ear cress) (158 aa), FASTA scores: opt: 131, E(): 0.77, (33.35% identity in 126 aa overlap); Q9S222|SCI51.18 putative transcriptional regulator from Streptomyces coelicolor (548 aa), FASTA scores: opt: 133, E(): 1.6, (36.25% identity in 149 aa overlap); etc. Also some similarity to other hypothetical Mycobacterium tuberculosis proteins e.g. O06292|Rv0341|MTCY13E10.01 (479 aa), FASTA scores: opt: 141, E(): 0.5, (31.2% identity in 170 aa overlap); AAK45760|MT1497.1 PE_PGRS family protein from strain CDC1551 (1408 aa), FASTA scores: opt: 137, E(): 2, (31.75% identity in 148 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3598353 | 3598904 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3222c|Rv3222c
MSSPVSSRRLANLVKESLQGSVLGGVVSDAVLPAVSDDVKPGAGEDAYRVPVVVAAGSGAVVQVGGLEVGSAAVAGEVADTVAELFVCRPTEPDVGDFVGLAGGAGDAGQAGQQFGLGVGVRGESFGARRRLALSTVGASGATAGLRKTHDGHHGCQARGALTQRRLYIGNPSEITDTRMVHQ
Bibliography
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
