Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3222c, (MTCY07D11.04), len: 183 aa. Hypothetical protein, with some similarity to Q9SZD2|F19B15.50|AT4G29020 glycine-rich protein like from Arabidopsis thaliana (Mouse-ear cress) (158 aa), FASTA scores: opt: 131, E(): 0.77, (33.35% identity in 126 aa overlap); Q9S222|SCI51.18 putative transcriptional regulator from Streptomyces coelicolor (548 aa), FASTA scores: opt: 133, E(): 1.6, (36.25% identity in 149 aa overlap); etc. Also some similarity to other hypothetical Mycobacterium tuberculosis proteins e.g. O06292|Rv0341|MTCY13E10.01 (479 aa), FASTA scores: opt: 141, E(): 0.5, (31.2% identity in 170 aa overlap); AAK45760|MT1497.1 PE_PGRS family protein from strain CDC1551 (1408 aa), FASTA scores: opt: 137, E(): 2, (31.75% identity in 148 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35983533598904-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3222c|Rv3222c
MSSPVSSRRLANLVKESLQGSVLGGVVSDAVLPAVSDDVKPGAGEDAYRVPVVVAAGSGAVVQVGGLEVGSAAVAGEVADTVAELFVCRPTEPDVGDFVGLAGGAGDAGQAGQQFGLGVGVRGESFGARRRLALSTVGASGATAGLRKTHDGHHGCQARGALTQRRLYIGNPSEITDTRMVHQ