Gene Rv3224A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3224A, len: 62 aa. Conserved hypothetical protein (possibly gene fragment), overlaps Rv3224. Similar to N-terminus of ML0799|AL583919_131 conserved hypothetical protein from Mycobacterium leprae (135 aa), FASTA scores: opt: 104, E(): 0.78, (59.37% identity in 32 aa overlap). Note that upstream ORF Rv3224B is similar to C-terminus of ML0799. There appears to be no frameshift as sequence is identical in strain CDC1551 and in Mycobacterium bovis. Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3600635 | 3600823 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3224A|Rv3224A
VRRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSKLSLKAAGGPRGAQSGHG
Bibliography
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
