Gene Rv3238c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv3238c, (MTCY20B11.13c), len: 244 aa. Probable conserved integral membrane protein, similar to several hypothetical proteins and transmembrane proteins e.g. Q9UN92|NRM29 multispanning nuclear envelope membrane protein NURIM (fragment) from Homo sapiens (Human) (261 aa), FASTA scores: opt: 281, E(): 3.3e-11, (30.7% identity in 189 aa overlap); Q9VEG9|CG7655 hypothetical protein from Drosophila melanogaster (Fruit fly) (253 aa), FASTA scores: opt: 242, E(): 1.1e-08, (27.7% identity in 242 aa overlap); BAB48937|MLR1600 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (222 aa), FASTA scores: opt: 137, E(): 0.066, (28.1% identity in 185 aa overlap); BAB57936|SAV1774 aesenical pump membrane protein homolog from Staphylococcus aureus subsp. aureus Mu50 (430 aa), FASTA scores: opt: 125, E(): 0.68, (25.7% identity in 144 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3613664 | 3614398 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3238c|Rv3238c
MKRYLTIIYGAASYLVFLVAFGYAIGFVGDVVVPRTVDHAIAAPIGQAVVVNLVLLGVFAVQHSVMARQGFKRWWTRFVPPSIERSTYVLLASVALLLLYWQWRTMPAVIWDVRQPAGRVALWALFWLGWATVLTSTFMINHFELFGLRQVYLAWRGKPYTEIGFQAHLLYRWVRHPIMLGFVVAFWATPMMTAGHLLFAIGATGYILVALQFEERDLLAALGDQYRDYRREVSMLLPWPHRHT
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
