Gene Rv3242c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3242c, (MTCY20B11.17c), len: 213 aa. Conserved hypothetical protein, highly similar in N-terminus to Q9CCI9|ML0776 hypothetical protein from Mycobacterium leprae (85 aa), FASTA scores: opt: 324, E(): 1.7e-13, (78.1% identity in 64 aa overlap). Also similar to Q9RUJ7|DR1389 putative competence protein COMF from Deinococcus radiodurans (219 aa), FASTA scores: opt: 223, E(): 6.3e-07, (35.8% identity in 215 aa overlap); BAB50338|MLL3453 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (240 aa), FASTA scores: opt: 218, E(): 1.4e-06, (28.5% identity in 224 aa overlap); Q9A9Y1|CC0830 competence protein F from Caulobacter crescentus (265 aa), FASTA scores: opt: 182, E(): 0.00026, (30.15% identity in 219 aa overlap); etc. Equivalent to AAK47682 from Mycobacterium tuberculosis strain CDC1551 (241 aa) but shorter 29 aa. Contains purine/pyrimidine phosphoribosyl transferases signature (PS00103). Seems to belong to purine/pyrimidine phosphoribosyl transferase family. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3621570 | 3622211 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3242c|Rv3242c
VLDLVLPLECGGCGAPATRWCAACAAELSVAAGEPHVVSPRVDPQVPVFALGRYAGVRRQAILAMKEHGRRDLVAPLACALIVGVDHLLSWGMLENPLTMVPAPTRRWAARRRGGDPVSRMARIAGATLGRHHDVTVVPALRMRALARDSVGLGASARERNITGRVLLRGQRPRNEVVLVDDIITTGATARESVRVLQAAGVRVGAVLAVAAA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
