Gene Rv3256c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3256c, (MTV015.01c-MTCY20B11.31c), len: 346 aa. Conserved protein, equivalent to Q9CCJ6|ML0764 hypothetical protein from Mycobacterium leprae (365 aa), FASTA scores: opt: 1574, E(): 1.4e-82, (75.35% identity in 365 aa overlap). Also similar to other hypothetical bacterial proteins e.g. Q9KZL8|SCE34.07c from Streptomyces coelicolor (375 aa), FASTA scores: opt: 171, E(): 0.012, (31.1% identity in 376 aa overlap); P55709|Y4YA_RHISN from Rhizobium sp. strain NGR234 (457 aa), FASTA scores: opt: 140, E(): 0.84, (28.75% identity in 233 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3636275 | 3637315 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3256c|Rv3256c
VNVARAIDLEDTEGLIAADRGALLRAASMAGAQVRAIAAAADEGELDLLRGSDRPRSVIWVTGRGTAETAGTILASTLGAGAAEPIVLASAAPPWVGPLDVLIVAGDDPGDPALVGAAAIGVRRGARVVVVAPYEGPLRDSTAGRVAVLEPRLRVPDEFGLSRYLAAGLAALQTVDPKLRIDLASLADELDAEALRNSAGREVFTNPAKALAARVSGCQLALAGDNAATLALARHGSSVMLRIANQVVAATRLSDAVVALRAGTPPDALFHDEEIDGPAPQRLRVLALALAGERTVVAARVAGLDDAYLVAAEDVPELLDAPVGSGGAVLAVRLEMAAVYLRLVRG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant