Gene Rv3275c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in purine biosynthesis (sixth step). This subunit can alone transform air to CAIR, but in association with PURK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting air to CAIR efficiently under physiological condition [catalytic activity: 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate = 1-(5-phosphoribosyl)-5-aminoimidazole + CO(2)]. |
| Product | Probable phosphoribosylaminoimidazole carboxylase catalytic subunit PurE (air carboxylase) (AIRC) |
| Comments | Rv3275c, (MTCY71.15c, PUR6), len: 174 aa. Probable purE, phosphoribosylaminoimidazole carboxylase catalytic subunit, equivalent to P46702|PUR6_MYCLE|pure|ML0736|B1308_F3_98 from Mycobacterium leprae (171 aa), FASTA scores: opt: 878, E(): 1.5e-43, (81.55% identity in 168 aa overlap). Also similar to others e.g. Q9AXD0|AIRC from Nicotiana tabacum (Common tobacco) (623 aa), FASTA scores: opt: 712, E(): 1.4e-33, (69.35% identity in 160 aa overlap) (similarity in C-terminal part for this one); Q44679|PUR6_CORAM from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (177 aa), FASTA scores: opt: 651, E(): 1.5e-30, (68.25% identity in 148 aa overlap); Q55498|PUR6_SYNY3|pure|SLL0901 from Synechocystis sp. strain PCC 6803 (176 aa), FASTA scores: opt: 639, E(): 7.1e-30, (60.5% identity in 167 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | The product of this CDS corresponds to spot 3_407 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (See Mattow et al., 2001). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3658114 | 3658638 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3275c|purE
MTPAGERPRVGVIMGSDSDWPVMADAAAALAEFDIPAEVRVVSAHRTPEAMFSYARGAAERGLEVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLGRLDGLDSLLSIVQMPAGVPVATVSIGGAGNAGLLAVRMLGAANPQLRARIVAFQDRLADVVAAKDAELQRLAGKLTRD
Bibliography
- Mattow J, Jungblut PR, Schaible UE, Mollenkopf HJ, Lamer S, Zimny-Arndt U, Hagens K, Muller EC and Kaufmann SH [2001]. Identification of proteins from Mycobacterium tuberculosis missing in attenuated Mycobacterium bovis BCG strains. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
