Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3284, (MTCY71.24, unknown), len: 143 aa. Conserved hypothetical protein, with similarity to other bacterial hypothetical proteins e.g. Q9RXU0|DR0216 from Deinococcus radiodurans (147 aa), FASTA scores: opt: 425, E(): 9.1e-21, (46.55% identity in 146 aa overlap); BAB37094|ECS3671 from Escherichia coli strain O157:H7 (147 aa), FASTA scores: opt: 187, E(): 2.2e-05, (29.5% identity in 139 aa overlap); AAG57925|YGDK from Escherichia coli strain O157:H7 EDL933 (147 aa), FASTA scores: opt: 187, E(): 2.2e-05, (32.05% identity in 139 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36658183666249+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3284|Rv3284
MTAPASLPAPLAEVVSDFAEVQGQDKLRLLLEFANELPALPSHLAESAMEPVPECQSPLFLHVDASDPNRVRLHFSAPAEAPTTRGFASILAAGLDEQPAADILAVPEDFYTELGLAALISPLRLRGMSAMLARIKRRLREAD