Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPutative protein UsfY
CommentsRv3288c, (MTCY71.28c), len: 137 aa. UsfY, putative protein (see citation below). Has no significant homologues. May not be contranscribed with the usfX and sigF proteins.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36695863669999-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3288c|usfY
MGQIPPQPVRRVLPLMVVPGNGQKWRNRTETEEAMGDTYRDPVDHLRTTRPLAGESLIDVVHWPGYLLIVAGVVGGVGALAAFGTGHHAEGMTFGVVAIVVTVVGLAWLAFEHRRIRKIADRWYTEHPEVRRQRLAG