Gene Rv3297
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in damage reversal. DNA N-glycosylase with an AP lyase activity. Required for the repair of oxidative DNA damage (oxidized pyrimidines). |
| Product | Probable endonuclease VIII Nei |
| Comments | Rv3297, (MTCY71.37, MT3396), len: 255 aa. Probable nei, endonuclease VIII (see citation below), similar to others e.g. O86820|END8_STRCO|NEI|SC7C7.15c from Streptomyces coelicolor (276 aa), FASTA scores: opt: 770, E(): 1.2e-42, (50.35% identity in 268 aa overlap); P50465|END8_ECOLI|NEI|B0714 from Escherichia coli strain K12 (262 aa), FASTA scores: opt: 310, E(): 6.3e-13, (28.1% identity in 267 aa overlap); AAG55037|NEI from Escherichia coli strain O157:H7 EDL933 (263 aa), FASTA scores: opt: 301, E(): 2.4e-12, (27.7% identity in 267 aa overlap); etc. Belongs to the FPG family. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3681320 | 3682087 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3297|nei
MPEGDTVWHTAATLRRHLAGRTLTRCDIRVPRFAAVDLTGEVVDEVISRGKHLFIRTGTASIHSHLQMDGSWRVGNRPVRVDHRARIILEANQQEQAIRVVGVDLGLLEVIDRHNDGAVVAHLGPDLLADDWDPQRAAANLIVAPDRPIAEALLDQRVLAGIGNVYCNELCFVSGVLPTAPVSAVADPRRLVTRARDMLWVNRFRWNRCTTGDTRAGRRLWVYGRAGQGCRRCGTLIAYDTTDERVRYWCPACQR
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
