Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in damage reversal. DNA N-glycosylase with an AP lyase activity. Required for the repair of oxidative DNA damage (oxidized pyrimidines).
ProductProbable endonuclease VIII Nei
CommentsRv3297, (MTCY71.37, MT3396), len: 255 aa. Probable nei, endonuclease VIII (see citation below), similar to others e.g. O86820|END8_STRCO|NEI|SC7C7.15c from Streptomyces coelicolor (276 aa), FASTA scores: opt: 770, E(): 1.2e-42, (50.35% identity in 268 aa overlap); P50465|END8_ECOLI|NEI|B0714 from Escherichia coli strain K12 (262 aa), FASTA scores: opt: 310, E(): 6.3e-13, (28.1% identity in 267 aa overlap); AAG55037|NEI from Escherichia coli strain O157:H7 EDL933 (263 aa), FASTA scores: opt: 301, E(): 2.4e-12, (27.7% identity in 267 aa overlap); etc. Belongs to the FPG family.
Functional categoryInformation pathways
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36813203682087+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3297|nei
MPEGDTVWHTAATLRRHLAGRTLTRCDIRVPRFAAVDLTGEVVDEVISRGKHLFIRTGTASIHSHLQMDGSWRVGNRPVRVDHRARIILEANQQEQAIRVVGVDLGLLEVIDRHNDGAVVAHLGPDLLADDWDPQRAAANLIVAPDRPIAEALLDQRVLAGIGNVYCNELCFVSGVLPTAPVSAVADPRRLVTRARDMLWVNRFRWNRCTTGDTRAGRRLWVYGRAGQGCRRCGTLIAYDTTDERVRYWCPACQR