Gene Rv3298c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; lipolytic enzyme involved in cellular metabolism. |
| Product | Possible esterase lipoprotein LpqC |
| Comments | Rv3298c, (MTCY71.38c), len: 304 aa. Possible lpqC, esterase lipoprotein, equivalent to Q9CCL5|LPQC|ML0715 putative secreted hydrolase from Mycobacterium leprae (304 aa), FASTA scores: opt: 1543, E(): 1.3e-87, (71.6% identity in 303 aa overlap); and Q49658|B1308_F2_43 tubulin family protein from Mycobacterium leprae (302 aa), FASTA scores: opt: 1541, E(): 1.7e-87, (72.0% identity in 300 aa overlap). Also similar to Q9I5Z3|PA0543 hypothetical protein from Pseudomonas aeruginosa (322 aa), FASTA scores: opt: 439, E(): 8.9e-20, (32.3% identity in 319 aa overlap); Q9F2K9|SCH63.19c putative secreted protein from Streptomyces coelicolor (348 aa), FASTA scores: opt: 394, E(): 5.5e-17, (30.25% identity in 334 aa overlap); etc. And similar to O86367|LPQP|Rv0671|MTCI376.03c from Mycobacterium tuberculosis strain H37Rv (280 aa), FASTA scores: opt: 519, E(): 9.8e-25, (39.25% identity in 275 aa overlap). Probably lipoprotein, esterase membrane-bound, with 18 aa signal sequence as it contains appropriately positioned (PS00013) Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3682110 | 3683024 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3298c|lpqC
MPWARMLSLIVLMVCLAGCGGDQLLARHASSVATFQFGGLTRSYRLHVPPAEPSGLVISLHGGGGTGAGQEALTDFDAVADAADLLVVYPDGYDKSWADGRGASPADRRHLDDVGFLVALAAKLVHDFDIAPGHVFATGMSNGGFMSNRLACDRADIFAAVAPVAGTLGVGVTCNPSRPVSVLEAHGTADPLVPFNGGAVRGRGGLSHSISVASLVDRWRAVDGCQGDPSAAELPDVGDGTMVHLFDSSSCAAGTEVISYQIDNGGHTWPGGRQYLPKAVIGATTRAFDGSQVIAQFFATHGRD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
