Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3300c, (MTCI418A.02c), len: 305 aa. Conserved hypothetical protein, similar to various proteins (notably pseudoridine synthase family proteins) e.g. Q9RJ76|SCI41.08 putative ribosomal pseudouridine synthase from Streptomyces coelicolor (324 aa), FASTA scores: opt: 876, E(): 4.5e-48, (52.1% identity in 313 aa overlap); Q9I272|PA2043 hypothetical protein from Pseudomonas aeruginosa (300 aa), FASTA scores: opt: 676, E(): 1.8e-35, (42.55% identity in 268 aa overlap); Q9JZW8|NMB0867 YABO/YCEC/SFHB family protein from Neisseria meningitidis (serogroup B) (307 aa), FASTA scores: opt: 597, E(): 1.8e-30, (42.9% identity in 282 aa overlap); Q9JUY2|NMA1085 hypothetical protein from Neisseria meningitidis (serogroup A) (307 aa), FASTA scores: opt: 597, E(): 1.8e-30, (42.9% identity in 282 aa overlap); Q12362|RIB2_YEAST|RIB2|YOL066C DRAP deaminase (pseudouridine synthase family protein) from Saccharomyces cerevisiae (Baker's yeast) (591 aa), FASTA scores: opt: 338, E(): 6.9e-14, (32.95% identity in 246 aa overlap); Q9RTS2|DR1684 putative pseudouridine synthase from Deinococcus radiodurans (321 aa), FASTA scores: opt: 319, E(): 6.5e-13, (32.75% identity in 235 aa overlap); etc. Also similar to Mycobacterium tuberculosis hypothetical protein Q10786|Y04P_MYCTU|MTCY48.25c|Rv1540|MT1592 (308 aa) (28.8% identity in 299 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36859833686900-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3300c|Rv3300c
VALRPEDRLLSVHDVLGPVRVRLLGGSVLAELTARFGVAARAKVLAGEVVDDDGAVVDSGTVLPPGSVVHLYRDLPDEVPVPFDVPVLHQDADIVVVDKPHFLATMPRGRHVAQTALVRLRRELGLPELSPAHRLDRLTAGVLLFTTRREVRGSYQTMFARGLVRKTYLARAPVAPGLALPRLVRSRIVKRRGHLQAVCEPGVPNAETLVERIARDGLYRLTPTTGRTHQLRVHMAALGIPIMGDPLYPNVISVAAHDFSTPLQLLAQRIEFDDPLTGSHREFASTRTLTGATLPTWSAAADCRP