Gene Rv3303c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in energy metabolism. Can catalyze the reduction of electron acceptors such as 2,6-dimethyl-1,4-benzoquinone (DMBQ) and 5-hydroxy-1,4-napthaquinone (5-HNQ) [catalytic activity: NAD(P)H + a quinone + H+ -> a quinol + NAD(P)+]. |
| Product | NAD(P)H quinone reductase LpdA |
| Comments | Rv3303c, (MTV016.02c), len: 493 aa. Probable lpdA, quinone reductase, similar to e.g. Q9EWV3|2SCK31.22c putative oxidoreductase from Streptomyces coelicolor (475 aa), FASTA scores: opt: 1420, E(): 2.4e-77, (54.9% identity in 471 aa overlap); Q9A7J2|CC1731 lipoamide dehydrogenase (E3 component,pyruvate dehydrogenase complex) from Caulobacter crescentus (466 aa), FASTA scores: opt: 696, E(): 3.6e-34, (29.6% identity in 463 aa overlap); Q04829|LPD|DLDH_HALVO dihydrolipoamide dehydrogenase from Halobacterium volcanii (Haloferax volcanii) (474 aa), FASTA scores: opt: 675, E(): 6.5e-33, (29.3% identity in 471 aa overlap); P50970|DLDH_ZYMMO|LPD dihydrolipoamide dehydrogenase from Zymomonas mobilis, FASTA scores: opt: 658, E(): 6.6e-32, (30.4% identity in 464 aa overlap); etc. Belongs to the pyridine nucleotide-disulfide oxidoreductases class-I. Cofactor: FAD. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Balb/c mice were infected with M. tuberculosis H37Rv transformed with sense (MTS) or antisense (MTAS) constructs of Rv3303c; MTS showed increased virulence while MTAS was attenuated, compared to H37Rv with vector control (weight of mice, lung pathology, CFU in lungs, survival of mice) (See Akhtar et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3689457 | 3690938 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3303c|lpdA
VVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAEQLALVPHHLPTSN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Argyrou A et al. [2004]. Characterization of a new member of the flavoprotein disulfide reductase family of enzymes from Mycobacterium tuberculosis. Function Product Structure
- Akhtar P et al. [2006]. Rv3303c of Mycobacterium tuberculosis protects tubercle bacilli against oxidative stress in vivo and contributes to virulence in mice. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant