Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in energy metabolism. Can catalyze the reduction of electron acceptors such as 2,6-dimethyl-1,4-benzoquinone (DMBQ) and 5-hydroxy-1,4-napthaquinone (5-HNQ) [catalytic activity: NAD(P)H + a quinone + H+ -> a quinol + NAD(P)+].
ProductNAD(P)H quinone reductase LpdA
CommentsRv3303c, (MTV016.02c), len: 493 aa. Probable lpdA, quinone reductase, similar to e.g. Q9EWV3|2SCK31.22c putative oxidoreductase from Streptomyces coelicolor (475 aa), FASTA scores: opt: 1420, E(): 2.4e-77, (54.9% identity in 471 aa overlap); Q9A7J2|CC1731 lipoamide dehydrogenase (E3 component,pyruvate dehydrogenase complex) from Caulobacter crescentus (466 aa), FASTA scores: opt: 696, E(): 3.6e-34, (29.6% identity in 463 aa overlap); Q04829|LPD|DLDH_HALVO dihydrolipoamide dehydrogenase from Halobacterium volcanii (Haloferax volcanii) (474 aa), FASTA scores: opt: 675, E(): 6.5e-33, (29.3% identity in 471 aa overlap); P50970|DLDH_ZYMMO|LPD dihydrolipoamide dehydrogenase from Zymomonas mobilis, FASTA scores: opt: 658, E(): 6.6e-32, (30.4% identity in 464 aa overlap); etc. Belongs to the pyridine nucleotide-disulfide oxidoreductases class-I. Cofactor: FAD.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Balb/c mice were infected with M. tuberculosis H37Rv transformed with sense (MTS) or antisense (MTAS) constructs of Rv3303c; MTS showed increased virulence while MTAS was attenuated, compared to H37Rv with vector control (weight of mice, lung pathology, CFU in lungs, survival of mice) (See Akhtar et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36894573690938-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3303c|lpdA
VVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAEQLALVPHHLPTSN