Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3304, (MTV016.03), len: 159 aa. Conserved protein, very similar to Q9CCL6|ML0711 hypothetical protein from Mycobacterium leprae (159 aa), FASTA scores: opt: 1041, E(): 6.1e-62, (91.8% identity in 159 aa overlap); and Q49927|L308_F3_97 from M. leprae (174 aa), FASTA scores: opt: 974, E(): 1.8e-57, (91.2% identity in 149 aa overlap). Also highly similar to Q9AD81|SCK13.10c conserved hypothetical protein from Streptomyces coelicolor (145 aa), FASTA scores: opt: 615, E(): 7.8e-34, (60.55% identity in 147 aa overlap); and shows some similarity to other various hypotheticals proteins. ORF continues upstream with possible start at 2198 (equivalent to AAK47746 from Mycobacterium tuberculosis strain CDC1551 (212 aa) but shorter 53 aa).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36911413691620+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3304|Rv3304
VPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPARNIGPGTIA