Gene Mb3332
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3332, -, len: 159 aa. Equivalent to Rv3304, len: 159 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 159 aa overlap). Hypothetical conserved protein, very similar to Q9CCL6|ML0711 HYPOTHETICAL PROTEIN from Mycobacterium leprae (159 aa),FASTA scores: opt: 1041, E(): 6.1e-62, (91.8% identity in 159 aa overlap); and Q49927|L308_F3_97 from M. leprae (174 aa), FASTA scores: opt: 974, E(): 1.8e-57, (91.2% identity in 149 aa overlap) . Also highly similar to Q9AD81|SCK13.10c CONSERVED HYPOTHETICAL PROTEIN from Streptomyces coelicolor (145 aa), FASTA scores: opt: 615,E(): 7.8e-34, (60.55% identity in 147 aa overlap); and shows some similarity to other various hypotheticals proteins. ORF continues upstream with possible start at 2198 (equivalent to AAK47746 from Mycobacterium tuberculosis strain CDC1551 (212 aa) but shorter 53 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3645666 | 3646145 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3332|Mb3332
MPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPARNIGPGTIA
Bibliography
No article yet recorded
