Gene Rv3307 (punA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in purine nucleoside salvage. Cleavage of guanosine or inosine to respective BASES and sugar-1-phosphate molecules [catalytic activity: purine nucleoside + orthophosphate = purine + alpha-D-ribose 1-phosphate]. |
| Product | Probable purine nucleoside phosphorylase DeoD (inosine phosphorylase) (PNP) |
| Comments | Rv3307, (MTV016.06), len: 268 aa. Probable deoD (alternate gene name: punA), purine nucleoside phosphorylase, similar to others especially P46862|PUNA_MYCLE|DEOD_MYCLE|ML0707|L308_F2_56 from M. leprae (268 aa), FASTA scores: opt: 1373, E(): 1.5e-74, (82.05% identity in 262 aa overlap); Q9EWV2|2SCK31.24 from Streptomyces coelicolor (274 aa), FASTA scores: opt: 1026, E(): 6.4e-54, (60.5% identity in 266 aa overlap); P81989|PUNA_CELSP from Cellulomonas sp (282 aa), FASTA scores: opt: 963, E(): 3.6e-50, (58.9% identity in 270 aa overlap); Q9X1T2|TM1596 from Thermotoga maritima (265 aa), FASTA scores: opt: 584, E(): 1.1e-27, (39.55% identity in 263 aa overlap); etc. Belongs to the PNP/MTAP family 2 of phosphorylases. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3694054 | 3694860 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3307|deoD
VADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Bibliography
- Shi W et al. [2001]. Structures of purine nucleoside phosphorylase from Mycobacterium tuberculosis in complexes with immucillin-H and its pieces. Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lewandowicz A et al. [2003]. Over-the-barrier transition state analogues and crystal structure with Mycobacterium tuberculosis purine nucleoside phosphorylase. Structure
- Nolasco DO et al. [2004]. Crystallographic structure of PNP from Mycobacterium tuberculosis at 1.9A resolution. Structure
- Ducati RG et al. [2009]. Substrate specificity and kinetic mechanism of purine nucleoside phosphorylase from Mycobacterium tuberculosis. Biochemistry
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Ducati RG et al. [2010]. Crystallographic and docking studies of purine nucleoside phosphorylase from Mycobacterium tuberculosis. Structure
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant