Gene Rv3310
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in cellular metabolism: acting on ester bonds [catalytic activity: an orthophosphoric monoester + H(2)O = an alcohol + orthophosphate]. |
| Product | Acid phosphatase (acid phosphomonoesterase) (phosphomonoesterase) (glycerophosphatase) |
| Comments | Rv3310, (MTV016.09), sapM, len: 299 aa. Secreted acid phosphatase, with N-terminal sequence beginning with ASAL..., (see Saleh and Belisle, 2000). Similar to several fungal or bacterial acid phosphatases e.g. BAB50846|MLR4110 from Rhizobium loti (Mesorhizobium loti) (292 aa), FASTA scores: opt: 460, E(): 4.8e-22, (38.65% identity in 295 aa overlap); P34724|PHOA_ASPNG from Aspergillus niger (417 aa), FASTA scores: opt: 172, E(): 0.0013, (29.1% identity in 306 aa overlap); P08540|PHOX_KLULA from Kluyveromyces lactis (Yeast) (421 aa), FASTA scores: opt: 170, E(): 0.0018, (27.8% identity in 266 aa overlap); P37274|PHOA_PENCH from Penicillium chrysogenum (412 aa), FASTA scores: opt: 163, E(): 0.0049, (29.05% identity in 303 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3697198 | 3698097 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3310|sapM
MLRGIQALSRPLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTFAHVVIVVEENRSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYLALFAGNTFGLTKNTCPVNGGALPNLGSELLSAGYTFMGFAEDLPAVGSTVCSAGKYARKHVPWVNFSNVPTTLSVPFSAFPKPQNYPGLPTVSFVIPNADNDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTWDEDDGSSRNQIPTVFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD
Bibliography
- Saleh MT et al. [2000]. Secretion of an acid phosphatase (SapM) by Mycobacterium tuberculosis that is similar to eukaryotic acid phosphatases. Biochemistry
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant