Gene Mb3338
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | acid phosphatase (acid phosphomonoesterase) (phosphomonoesterase) (glycerophosphatase) |
| Comments | Mb3338, -, len: 299 aa. Equivalent to Rv3310, len: 299 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 299 aa overlap). Possible acid phosphatase (EC 3.1.3.2), similar to several fungal or bacterial acid phosphatases e.g. BAB50846|MLR4110 from Rhizobium loti (Mesorhizobium loti) (292 aa), FASTA scores: opt: 460, E(): 4.8e-22, (38.65% identity in 295 aa overlap); P34724|PHOA_ASPNG from Aspergillus niger (417 aa), FASTA scores: opt: 172, E(): 0.0013, (29.1% identity in 306 aa overlap); P08540|PHOX_KLULA from Kluyveromyces lactis (Yeast) (421 aa), FASTA scores: opt: 170, E(): 0.0018, (27.8% identity in 266 aa overlap); P37274|PHOA_PENCH from Penicillium chrysogenum (412 aa),FASTA scores: opt: 163, E(): 0.0049, (29.05% identity in 303 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3651723 | 3652622 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3338|sapm
MLRGIQALSRPLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTFAHVVIVVEENRSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYLALFAGNTFGLTKNTCPVNGGALPNLGSELLSAGYTFMGFAEDLPAVGSTVCSAGKYARKHVPWVNFSNVPATLSVPFSAFPKPQNYPGLPTVSFVIPNADNDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTWDEDDGSSRNQIPTVFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD
Bibliography
No article yet recorded