Gene Rv3312c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3312c, (MTV016.11), len: 308 aa. Hypothetical protein, similar to various proteins (principally hypothetical unknowns or hydrolases) e.g. Q9M9P2|T17B22.7 hypothetical protein from Arabidopsis thaliana (Mouse-ear cress) (326 aa), FASTA scores: opt: 261, E(): 2.6e-09, (27.55% identity in 323 aa overlap); Q9FWB6 putative alpha/beta hydrolase from Oryza sativa (Rice) (354 aa), FASTA scores: opt: 241, E(): 4.9e-08, (28.9% identity in 301 aa overlap) (note that Q9FWB6 correspond to Q9FWB5 putative alpha/beta hydrolase (353 aa) but longer 1 aa; and to Q9AUW9 hypothetical protein (332 aa) but longer 22 aa); Q9M382|F24B22.200 hypothetical protein from Arabidopsis thaliana (Mouse-ear cress) (342 aa), FASTA scores: opt: 222, E(): 8e-07, (27.6% identity in 319 aa overlap); Q9HWM9|PA4152 probable hydrolase from Pseudomonas aeruginosa (370 aa), FASTA scores: opt: 176, E(): 0.00071, (29.2% identity in 209 aa overlap); Q9L3R2 hydrolase from Rhizobium leguminosarum (261 aa), FASTA scores: opt: 174, E(): 0.00071, (28.9% identity in 173 aa overlap); P49323|PRXC_STRLI|CPO|CPOL non-heme chloroperoxidase from Streptomyces lividans (275 aa), FASTA scores: opt: 172, E(): 0.001, (30.9% identity in 194 aa overlap) (similarity only at N-terminus for this one); etc. Some similarity in N-terminal part to non-heme chloroperoxidases. Also similar to O05293|Rv1191|MTCI364.03 hypothetical protein from M. tuberculosis (304 aa), FASTA scores: opt: 417, E(): 3.1e-19, (32.6% identity in 279 aa overlap) (note that Rv1191 is equivalent to AAK45485 from Mycobacterium tuberculosis strain CDC1551 but shorter 14 aa, and that AAK45485 is annoted Hydrolase, alpha/beta hydrolase family). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3699404 | 3700330 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3312c|Rv3312c
LTGPPPSLPERIRTDEADVLMLPDGRALAYLEWGDSTGYPAFYFHGTPSSRLEGAFADGAARRTGFRLIAIDRPGYGRSTFQAGRNFRDWPADVCALADAFELEEFGVVGHSGAGPHLFACGAVIPRTRLAFVGALGPWGPLATPDIMRSLNAADRCYARLARSGPRLFGALFAPLGWCAKYTPGLFSTLLAAAVPAADKHLLSDERFGRHLRAIQLEAFRQGSRGAAYESFLQFRPWGFDLAEVAVPTHIWLGDRDSFVPRAMGEYLQRAIPHVDLHWAHGKGHFNIEDWDAILAACALDIGKRRGG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant