Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3312c, (MTV016.11), len: 308 aa. Hypothetical protein, similar to various proteins (principally hypothetical unknowns or hydrolases) e.g. Q9M9P2|T17B22.7 hypothetical protein from Arabidopsis thaliana (Mouse-ear cress) (326 aa), FASTA scores: opt: 261, E(): 2.6e-09, (27.55% identity in 323 aa overlap); Q9FWB6 putative alpha/beta hydrolase from Oryza sativa (Rice) (354 aa), FASTA scores: opt: 241, E(): 4.9e-08, (28.9% identity in 301 aa overlap) (note that Q9FWB6 correspond to Q9FWB5 putative alpha/beta hydrolase (353 aa) but longer 1 aa; and to Q9AUW9 hypothetical protein (332 aa) but longer 22 aa); Q9M382|F24B22.200 hypothetical protein from Arabidopsis thaliana (Mouse-ear cress) (342 aa), FASTA scores: opt: 222, E(): 8e-07, (27.6% identity in 319 aa overlap); Q9HWM9|PA4152 probable hydrolase from Pseudomonas aeruginosa (370 aa), FASTA scores: opt: 176, E(): 0.00071, (29.2% identity in 209 aa overlap); Q9L3R2 hydrolase from Rhizobium leguminosarum (261 aa), FASTA scores: opt: 174, E(): 0.00071, (28.9% identity in 173 aa overlap); P49323|PRXC_STRLI|CPO|CPOL non-heme chloroperoxidase from Streptomyces lividans (275 aa), FASTA scores: opt: 172, E(): 0.001, (30.9% identity in 194 aa overlap) (similarity only at N-terminus for this one); etc. Some similarity in N-terminal part to non-heme chloroperoxidases. Also similar to O05293|Rv1191|MTCI364.03 hypothetical protein from M. tuberculosis (304 aa), FASTA scores: opt: 417, E(): 3.1e-19, (32.6% identity in 279 aa overlap) (note that Rv1191 is equivalent to AAK45485 from Mycobacterium tuberculosis strain CDC1551 but shorter 14 aa, and that AAK45485 is annoted Hydrolase, alpha/beta hydrolase family).
Functional categoryConserved hypotheticals
TranscriptomicsDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36994043700330-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3312c|Rv3312c
LTGPPPSLPERIRTDEADVLMLPDGRALAYLEWGDSTGYPAFYFHGTPSSRLEGAFADGAARRTGFRLIAIDRPGYGRSTFQAGRNFRDWPADVCALADAFELEEFGVVGHSGAGPHLFACGAVIPRTRLAFVGALGPWGPLATPDIMRSLNAADRCYARLARSGPRLFGALFAPLGWCAKYTPGLFSTLLAAAVPAADKHLLSDERFGRHLRAIQLEAFRQGSRGAAYESFLQFRPWGFDLAEVAVPTHIWLGDRDSFVPRAMGEYLQRAIPHVDLHWAHGKGHFNIEDWDAILAACALDIGKRRGG