Gene Mb3340c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | CONSERVED HYPOTHETICAL PROTEIN |
Comments | Mb3340c, -, len: 308 aa. Equivalent to Rv3312c,len: 308 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 308 aa overlap). Hypothetical protein,similar to various proteins (principally hypothetical unknowns or hydrolases) e.g. Q9M9P2|T17B22.7 HYPOTHETICAL PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (326 aa), FASTA scores: opt: 261, E(): 2.6e-09, (27.55% identity in 323 aa overlap); Q9FWB6 PUTATIVE ALPHA/BETA HYDROLASE from Oryza sativa (Rice) (354 aa), FASTA scores: opt: 241, E(): 4.9e-08, (28.9% identity in 301 aa overlap) (note that Q9FWB6 correspond to Q9FWB5 PUTATIVE ALPHA/BETA HYDROLASE (353 aa) but longer 1 aa; and to Q9AUW9 HYPOTHETICAL PROTEIN (332 aa) but longer 22 aa); Q9M382|F24B22.200 HYPOTHETICAL PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (342 aa), FASTA scores: opt: 222, E(): 8e-07, (27.6% identity in 319 aa overlap); Q9HWM9|PA4152 PROBABLE HYDROLASE from Pseudomonas aeruginosa (370 aa), FASTA scores: opt: 176, E(): 0.00071,(29.2% identity in 209 aa overlap); Q9L3R2 HYDROLASE from Rhizobium leguminosarum (261 aa), FASTA scores: opt: 174,E(): 0.00071, (28.9% identity in 173 aa overlap); P49323|PRXC_STRLI|CPO|CPOL NON-HEME CHLOROPEROXIDASE (EC 1.11.1.10) from Streptomyces lividans (275 aa), FASTA scores: opt: 172, E(): 0.001, (30.9% identity in 194 aa overlap) (similarity only at N-terminus for this one); etc. Some similarity in N-terminal part to non-heme chloroperoxidases. Also similar to O05293|Rv1191|MTCI364.03 HYPOTHETICAL PROTEIN from M. tuberculosis (304 aa), FASTA scores: opt: 417, E(): 3.1e-19, (32.6% identity in 279 aa overlap) (note that Rv1191 is equivalent to AAK45485 from Mycobacterium tuberculosis strain CDC1551 but shorter 14 aa, and that AAK45485 is annoted Hydrolase, alpha/beta hydrolase family). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3653929 | 3654855 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3340c|Mb3340c MTGPPPSLPERIRTDEADVLMLPDGRALAYLEWGDSTGYPAFYFHGTPSSRLEGAFADGAARRTGFRLIAIDRPGYGRSTFQAGRNFRDWPADVCALADAFELEEFGVVGHSGAGPHLFACGAVIPRTRLAFVGALGPWGPLATPDIMRSLNAADRCYARLARSGPRLFGALFAPLGWCAKYTPGLFSTLLAAAVPAADKHLLSDERFGRHLRAIQLEAFRQGSRGAAYESFLQFRPWGFDLAEVAVPTHIWLGDRDSFVPRAMGEYLQRAIPHVDLHWAHGKGHFNIEDWDAILAACALDIGKRRGG
Bibliography
No article yet recorded