Gene Rv3322c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could cause methylation. |
| Product | Possible methyltransferase |
| Comments | Rv3322c, (MTV016.22c), len: 204 aa. Conserved hypothetical protein, showing weak similarity to proteins including several methyltransferases e.g. Q9X9V1|ORF8 putative methyltransferase from Streptomyces coelicolor (208 aa), FASTA scores: opt: 193, E(): 1e-05, (36.35% identity in 132 aa overlap); and Q9XA90|SCF43A.25c putative methyltransferase from Streptomyces coelicolor (215 aa), FASTA scores: opt: 161, E(): 0.0014, (32.05% identity in 131 aa overlap); P74712|SLR1183 hypothetical 21.3 KDA protein from Synechocystis sp. strain PCC 6803 (194 aa), FASTA scores: opt: 155, E(): 0.0032, (27.35% identity in 150 aa overlap); Q9ABW8|CC0102 rRNA methyltransferase RSMB from Caulobacter crescentus (429 aa), FASTA scores: opt: 148, E(): 0.018, (31.5% identity in 162 aa overlap); etc. Also highly similar to O05796|Rv3120|MTCY164.30 hypothetical 21.8 KDA protein from Mycobacterium tuberculosis (200 aa), FASTA scores: opt: 691, E(): 1.2e-38, (56.5% identity in 200 aa overlap); and shows weak similarity to O69667|Rv3699|MTV025.047 putative methyltransferase from Mycobacterium tuberculosis (233 aa), FASTA scores: opt: 155, E(): 0.0037, (29.15% identity in 168 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3708438 | 3709052 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3322c|Rv3322c
MSVQTDPALREHPNRVDWNARYERAGSAHAPFAPVPWLADVLRAGVPDGPVLELASGRSGTALALAAHGRQVTAIDVSDVALLQLDSEAVRRGVADRLNLVQADLGCWEPGETRFALVLSRLFWDAAIFHRACEAVMPGGVLAWESLALSGAEAGTASAKRRVKPGEPACLLPADFTVVHEGQGNCDSAPSRIMIARRSPLPGA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
