Gene Rv3324A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in molybdopterin biosynthesis. Catalyzes the dehydratation of 4A-hydroxytetrahydropterins [catalytic activity: (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4A-hydroxypterin = (6R)-6-(L-erythro-1,2- dihydroxypropyl)-7,8-dihydro-6H-pterin + H(2)O]. |
| Product | Probable fragment of pterin-4-alpha-carbinolamine dehydratase MOAB3 (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-a-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD) |
| Comments | Rv3324A, len: 44 aa. Probable pseudogene moaB3, fragment of pterin-4-alpha-carbinolamine dehydratase, equivalent to C-terminus of MT3426|Q8VJ32 pterin-4-alpha-carbinolamine dehydratase from Mycobacterium tuberculosis strain CDC1551 (124 aa), FASTA scores: opt: 309, E(): 1.1e-20, (100.000% identity in 44 aa overlap), and C-terminus of Mb3354c|moaB3 probable pterin-4-alpha-carbinolamine dehydratase from Mycobacterium bovis (124 aa). Note that a deletion of DNA (RvD5 region) in Mycobacterium tuberculosis strain H37Rv resulted in a truncated CDS comparatively to Mycobacterium bovis or Mycobacterium tuberculosis strain CDC1551 genomes (see citations below). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3710245 | 3710379 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3324A|Rv3324A
VHNKRSVRLTCWTRQMHCLTRVDFDLAEAFSAVHDEQCSQQVAR
Bibliography
- Gordon SV et al. [1999]. Identification of variable regions in the genomes of tubercle bacilli using bacterial artificial chromosome arrays. Secondary Sequence
- Brosch R et al. [1999]. Genomic analysis reveals variation between Mycobacterium tuberculosis H37Rv and the attenuated M. tuberculosis H37Ra strain. Sequence
