Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released.
ProductProbable alternative RNA polymerase sigma factor (fragment) SigJ
CommentsRv3328c, (MTV016.28c), len: 312 aa. Probable sigJ, alternative RNA polymerase sigma factor (see citations below), highly similar to many e.g. Q9K3H7|2SCG18.10c from Streptomyces coelicolor (295 aa), FASTA scores: opt: 642, E(): 7.3e-31, (42.8% identity in 292 aa overlap); Q9A3D8|CC3266 from Caulobacter crescentus (291 aa), FASTA scores: opt: 607, E(): 8.4e-29, (39.8% identity in 294 aa overlap); Q9RD74|SCF43.14c from Streptomyces coelicolor (324 aa), FASTA scores: opt: 555, E(): 1.1e-25, (41.1% identity in 297 aa overlap); etc. Similar also to U00022_20 from Mycobacterium leprae; and MTCI28_22 and MSU87307_1. Also similar to O50445|SIGI|Rv1189|MTV005.25|MTCI364.01 putative RNA polymerase sigma factor from Mycobacterium tuberculosis (290 aa), FASTA scores: opt: 426, E(): 4.2e-18, (32.65% identity in 294 aa overlap). Equivalent to AAK47774 from Mycobacterium tuberculosis strain CDC1551 (282 aa) but longer 30 aa. Contains probable helix-turn-helix motif at aa 129-150 (Score 1126, +3.02 SD). Belongs to the sigma-70 factor family, ECF subfamily.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37133943714332-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3328c|sigJ
MEVSEFEALRQHLMSVAYRLTGTVADAEDIVQEAWLRWDSPDTVIADPRAWLTTVVSRLGLDKLRSAAHRRETYTGTWLPEPVVTGLDATDPLAAVVAAEDARFAAMVVLERLRPDQRVAFVLHDGFAVPFAEVAEVLGTSEAAARQLASRARKAVTAQPALISGDPDPAHNEVVGRLMAAMAAGDLDTVVSLLHPDVTFTGDSNGKAPTAVRAVRGSDKVVRFILGLVQRYGPGLFGANQLALVNGELGAYTAGLPGVDGYRAMAPRITAITVRDGKVCALWDIANPDKFTGSPLKERRAQPTGRGRHHRN