Gene Rv3358 (yoeB, relE3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Toxin RelK |
| Comments | Rv3358, (MTV004.15), len: 85 aa. RelK, toxin, part of toxin-antitoxin (TA) operon with Rv3357 (See Cherny et al., 2004; Pandey and Gerdes, 2005), highly similar to other hypohetical proteins e.g. Q9Z4V8|SCBAC17D6.03 from Streptomyces coelicolor (84 aa), FASTA scores: opt: 393, E(): 1.1e-21, (59.75% identity in 82 aa overlap); P56605|YOEB_ECOLI from Escherichia coli (84 aa), FASTA scores: opt: 305, E(): 2.2e-15, (49.35% identity in 77 aa overlap); Q9Z5W7 putative doc protein from Francisella novicida (68 aa), FASTA scores: opt: 253, E(): 9.6e-12, (51.6% identity in 62 aa overlap); BAB58569|SAV2407 from Staphylococcus aureus subsp. aureus Mu50 (88 aa), FASTA scores: opt: 250, E(): 2e-11, (40.5% identity in 84 aa overlap); etc. |
| Functional category | - |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Operon | Rv3357 and Rv3358 are co-transcribed, by RT-PCR (See Korch et al., 2009). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv relE3|Rv3358 mutant is comparable to wild-type in vitro, in J774.1 macrophages, and in C57BL/6 mice (See Singh et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3771045 | 3771302 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3358|relK
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLKARYHY
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Cherny I et al. [2004]. The YefM antitoxin defines a family of natively unfolded proteins: implications as a novel antibacterial target. Product
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Kumar P et al. [2008]. Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. Structure
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Korch SB et al. [2009]. Three Mycobacterium tuberculosis Rel toxin-antitoxin modules inhibit mycobacterial growth and are expressed in infected human macrophages. Function Operon Product
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Singh R et al. [2010]. The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. Function Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant