Gene Mb3393
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | toxin relk |
Comments | Mb3393, -, len: 85 aa. Equivalent to Rv3358, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 85 aa overlap). Conserved hypohetical protein, highly similar to other hypohetical proteins e.g. Q9Z4V8|SCBAC17D6.03 from Streptomyces coelicolor (84 aa),FASTA scores: opt: 393, E(): 1.1e-21, (59.75% identity in 82 aa overlap); P56605|YOEB_ECOLI from Escherichia coli (84 aa), FASTA scores: opt: 305, E(): 2.2e-15, (49.35% identity in 77 aa overlap); Q9Z5W7 PUTATIVE DOC PROTEIN from Francisella novicida (68 aa), FASTA scores: opt: 253,E(): 9.6e-12, (51.6% identity in 62 aa overlap); BAB58569|SAV2407 from Staphylococcus aureus subsp. aureus Mu50 (88 aa), FASTA scores: opt: 250, E(): 2e-11, (40.5% identity in 84 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3724571 | 3724828 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3393|relk MRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLKARYHY
Bibliography
No article yet recorded