Gene Rv3362c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Probable ATP/GTP-binding protein |
| Comments | Rv3362c, (MTV004.19c), len: 193 aa. Probable ATP/GTP-binding protein, similar to others from Streptomyces coelicolor e.g. O86519|SC1C2.18c (174 aa), FASTA scores: opt: 731, E(): 9.8e-41, (66.85% identity in 169 aa overlap); Q9XAE1|SC6G9.41c (191 aa), FASTA scores: opt: 730, E(): 1.2e-40, (63.55% identity in 173 aa overlap); Q9L235|SC1A2.06 (184 aa), FASTA scores: opt: 650, E(): 1.9e-35, (55.95% identity in 177 aa overlap); Q9RJ74|SCI41.10c (176 aa), FASTA scores: opt: 618, E(): 2.3e-33, (55.9% identity in 161 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3773574 | 3774155 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3362c|Rv3362c
VALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
