Gene Rv3363c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv3363c, (MTV004.20c), len: 122 aa. Conserved hypothetical protein, similar to others from Streptomyces coelicolor e.g. O86523|SC1C2.23c (132 aa), FASTA scores: opt: 236, E(): 9e-09, (38.5% identity in 122 aa overlap); O86520|SC1C2.19c (190 aa), FASTA scores: opt: 231, E(): 2.7e-08, (41.0% identity in 122 aa overlap); Q9X834|SC9B1.14c (119 aa), FASTA scores: opt: 188, E(): 1.1e-05, (37.5% identity in 120 aa overlap); Q9ADJ4|SCBAC14E8.05 (113 aa), FASTA scores: opt: 167, E(): 0.00025, (33.05% identity in 109 aa overlap); etc. |
Functional category | Conserved hypotheticals |
Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3774136 | 3774504 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3363c|Rv3363c LFNPAGDRPKAGLVRPYTLTAGRTGTDVDLPLQAPVQTLPAGPAGRWPAYDMRRRILQLCIGSPSVAEISARLDLPVGVARVLVGDLVTSGYLRVHATLTDRSTRDERHELIGRTLRGLKAL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant