Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O].
ProductProbable enoyl-CoA hydratase (fragment) EchA18.1 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
CommentsRv3374, (MTV004.32), len: 82 aa. Probable echA18.1, enoyl-CoA hydratase C-terminus, similar to the C-terminus of several enoyl-CoA hydratases e.g. Q9I5I4|PA0745 from Pseudomonas aeruginosa (272 aa), FASTA scores: opt: 123, E(): 0.13, (34.55% identity in 81 aa overlap); P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 115, E(): 0.45, (32.95% identity in 82 aa overlap); Q9I002|PA2841 from Pseudomonas aeruginosa (263 aa), FASTA scores: opt: 108, E(): 1.4, (30.95% identity in 84 aa overlap); etc. Also some similarity to C-terminus of O29956|AF0285 3-hydroxyacyl-CoA dehydrogenase from Archaeoglobus fulgidus (658 aa), FASTA scores: opt: 116, E(): 0.81, (34.15% identity in 82 aa overlap); and other enzymes. And similar to other hydratases from Mycobacterium tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c probable enoyl-CoA hydratase (257 aa), FASTA scores: opt: 111, E(): 0.83, (36.05% identity in 86 aa overlap). This homology extends across the upstream TGA stop codon into the upstream ORF MTV004.28, suggesting possible readthrough of the previous stop codon. Note that previously known as echA18'.
Functional categoryLipid metabolism
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37883683788616+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3374|echA18.1
LVQKVVAPQDLAAATAKLVGQVCRQSAVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD