Gene Rv3374 (echA18')
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O]. |
| Product | Probable enoyl-CoA hydratase (fragment) EchA18.1 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) |
| Comments | Rv3374, (MTV004.32), len: 82 aa. Probable echA18.1, enoyl-CoA hydratase C-terminus, similar to the C-terminus of several enoyl-CoA hydratases e.g. Q9I5I4|PA0745 from Pseudomonas aeruginosa (272 aa), FASTA scores: opt: 123, E(): 0.13, (34.55% identity in 81 aa overlap); P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 115, E(): 0.45, (32.95% identity in 82 aa overlap); Q9I002|PA2841 from Pseudomonas aeruginosa (263 aa), FASTA scores: opt: 108, E(): 1.4, (30.95% identity in 84 aa overlap); etc. Also some similarity to C-terminus of O29956|AF0285 3-hydroxyacyl-CoA dehydrogenase from Archaeoglobus fulgidus (658 aa), FASTA scores: opt: 116, E(): 0.81, (34.15% identity in 82 aa overlap); and other enzymes. And similar to other hydratases from Mycobacterium tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c probable enoyl-CoA hydratase (257 aa), FASTA scores: opt: 111, E(): 0.83, (36.05% identity in 86 aa overlap). This homology extends across the upstream TGA stop codon into the upstream ORF MTV004.28, suggesting possible readthrough of the previous stop codon. Note that previously known as echA18'. |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3788368 | 3788616 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3374|echA18.1
LVQKVVAPQDLAAATAKLVGQVCRQSAVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
