Gene Mb3408
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable enoyl-coa hydratase (fragment) echa18.1 (enoyl hydrase) (unsaturated acyl-coa hydratase) (crotonase) |
| Comments | Mb3408, echA18, len: 296 aa. Equivalent to Rv3373 and Rv3374, len: 213 aa and 82 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 213 aa overlap and 100.0% identity in 82 aa overlap). Rv3373: Probable echA18, enoyl-CoA hydratase (EC 4.2.1.17),similar to others e.g. P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 423,E(): 3.4e-20, (37.95% identity in 174 aa overlap); Q9X7Q4|SC5F2A.31c from Streptomyces coelicolor (257 aa),FASTA scores: opt: 399, E(): 1.2e-18, (45.05% identity in 171 aa overlap); BAB52005|MLL5584 from Rhizobium loti (Mesorhizobium loti) (257 aa), FASTA scores: opt: 385,E(): 9.6e-18, (41.95% identity in 174 aa overlap); etc. Also some similarity to 3-HYDROXYBUTYRYL-COA DEHYDRATASES (EC 4.2.1.55) e.g. P52046|CRT_CLOAB from Clostridium acetobutylicum (261 aa), FASTA scores: opt: 414, E(): 1.3e-19, (38.3% identity in 175 aa overlap). And similar to other hydratases from Mycobacterium tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c PROBABLE ENOYL-COA HYDRATASE (257 aa), FASTA scores: opt: 365, E(): 1.9e-16, (39.1% identity in 174 aa overlap). BELONGS TO THE ENOYL-COA HYDRATASE/ISOMERASE FAMILY. Note that this homology extends across the stop codon and directly into the next ORF MTV004.29, suggesting a possible readthrough of the TGA stop codon. Rv3374: Probable echA18', enoyl-CoA hydratase C-terminus (EC 4.2.1.17), similar to the C-terminus of several enoyl-CoA hydratases e.g. Q9I5I4|PA0745 from Pseudomonas aeruginosa (272 aa), FASTA scores: opt: 123, E(): 0.13, (34.55% identity in 81 aa overlap); P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 115,E(): 0.45, (32.95% identity in 82 aa overlap); Q9I002|PA2841 from Pseudomonas aeruginosa (263 aa), FASTA scores: opt: 108, E(): 1.4, (30.95% identity in 84 aa overlap); etc. Also some similarity to C-terminus of O29956|AF0285 3-HYDROXYACYL-COA DEHYDROGENASE from Archaeoglobus fulgidus (658 aa), FASTA scores: opt: 116,E(): 0.81, (34.15% identity in 82 aa overlap); and other enzymes. And similar to other hydratases from M. tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c PROBABLE ENOYL-COA HYDRATASE (257 aa), FASTA scores: opt: 111, E(): 0.83, (36.05% identity in 86 aa overlap). This homology extends across the upstream TGA stop codon into the upstream ORF MTV004.28, suggesting possible readthrough of the previous stop codon. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis H37Rv, echA18 and echA18' exist as 2 genes. In Mycobacterium bovis, a single base transversion (t-g) leads to a single product. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3741366 | 3742256 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3408|echA18
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQNALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYNESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGFTEADTVARLIGPAALKYLLFSGELIGIEEAARWGLVQKVVAPQDLAAATAKLVGQVCRQSAVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD
Bibliography
No article yet recorded
