Gene Rv3386
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the transposition of the insertion sequence IS1560. |
| Product | Possible transposase |
| Comments | Rv3386, (MTV004.44), len: 234 aa. Possible transposase, showing very weak similarity to several is element transposases. Highly similar (but shorter) to P963659|MTCY10G2_13|Rv1036c from Mycobacterium tuberculosis (112 aa), FASTA scores: opt: 507, E(): 8.3e-25, (83.9% identity in 87 aa overlap). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3800092 | 3800796 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3386|Rv3386
VFRTVGDQASLWESVLPEELRRLPEELARVDALLDDSAFFCPFVPFFDPRMGRPSIPMETYLRLMFLKFRYRLGYESLCREVTDSITWRRFCRIPLEGSVPHPTTLMKLTTRCGEDAVAGLNEALLAKAASEKLLRTNKVRADTTVVEGDVGYPTDTGLLAKAVGSMARTVARIKAADAGSAPLGGSSGPRDRLQAAVTRRAATRSGAGLRAPDHRGASRDRRAGADRGCRGGT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
