Gene Rv3405c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May be involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein |
| Comments | Rv3405c, (MTCY78.23), len: 188 aa. Possible transcriptional regulator, showing weak similarity to other bacterial regulatory proteins e.g. Q9KE70|BH0987 from Bacillus halodurans (203 aa), FASTA scores: opt: 168, E(): 0.0016, (34.8% identity in 92 aa overlap); Q9A5F7|CC2493 Caulobacter crescentus (204 aa), FASTA scores: opt: 160, E(): 0.0051, (32.6% identity in 89 aa overlap); Q9RDR0|SC4A7.02 from Streptomyces coelicolor (227 aa), FASTA scores: opt: 159, E(): 0.0064, (37.0% identity in 189 aa overlap); etc. Also some similarity to hypothetical Mycobacterium tuberculosis regulatory proteins e.g. O05858|Rv3208|MTCY07D11.18c, MTCI125_6, MTCY7D11_18, MTCY10G2_30; etc. Contains potential helix-turn-helix motif from aa 39-60 (+2.97 SD). |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3824702 | 3825268 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3405c|Rv3405c
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant