Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay be involved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein
CommentsRv3405c, (MTCY78.23), len: 188 aa. Possible transcriptional regulator, showing weak similarity to other bacterial regulatory proteins e.g. Q9KE70|BH0987 from Bacillus halodurans (203 aa), FASTA scores: opt: 168, E(): 0.0016, (34.8% identity in 92 aa overlap); Q9A5F7|CC2493 Caulobacter crescentus (204 aa), FASTA scores: opt: 160, E(): 0.0051, (32.6% identity in 89 aa overlap); Q9RDR0|SC4A7.02 from Streptomyces coelicolor (227 aa), FASTA scores: opt: 159, E(): 0.0064, (37.0% identity in 189 aa overlap); etc. Also some similarity to hypothetical Mycobacterium tuberculosis regulatory proteins e.g. O05858|Rv3208|MTCY07D11.18c, MTCI125_6, MTCY7D11_18, MTCY10G2_30; etc. Contains potential helix-turn-helix motif from aa 39-60 (+2.97 SD).
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38247023825268-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3405c|Rv3405c
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH