Gene Rv3411c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyses the first reaction unique to GMP biosynthesis [catalytic activity: inosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH]. |
| Product | Probable inosine-5'-monophosphate dehydrogenase GuaB2 (imp dehydrogenase) (inosinic acid dehydrogenase) (inosinate dehydrogenase) (imp oxidoreductase) (inosine-5'-monophosphate oxidoreductase) (IMPDH) (IMPD) |
| Comments | Rv3411c, (MTCY78.17), len: 529 aa. Probable guaB2, inosine-5'-monophosphate (imp) dehydrogenase, equivalent to Q49729|IMDH_MYCLE|GUAB|ML0387|B1620_C3_238 inosine-5'-monophosphate dehydrogenase from Mycobacterium leprae (529 aa), FASTA scores: opt: 3154, E(): 4.4e-165, (92.45% identity in 529 aa overlap). Highly similar to other inosine-5'-monophosphate dehydrogenases e.g. Q9RHZ0|GUAB from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (506 aa), FASTA scores: opt: 2284, E(): 1.5e-117, (67.9% identity in 505 aa overlap); Q9L0I7|SCD63.02 from Streptomyces coelicolor (501 aa), FASTA scores: opt: 2178, E(): 9e-112, (67.2% identity in 491 aa overlap); O67820|IMDH_AQUAE|GUAB|AQ_2023 from Aquifex aeolicus (490 aa), FASTA scores: opt: 1820, E(): 3.2e-92, (58.1% identity in 487 aa overlap); etc. Also similar to Q50716|YY10_MYCTU|Rv3410c|MT3518|MTCY78.18 hypothetical 38.9 KDA protein from Mycobacterium tuberculosis (38.6% identity in 158 aa overlap). Contains PS00487 imp dehydrogenase / GMP reductase signature. Similar to other eukaryotic and prokaryotic IMPDH and to GMP reductase. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany and the Statens Serum Institute (Denmark) (see citations below). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3829930 | 3831519 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3411c|guaB2
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR
Bibliography
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
