Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyses the first reaction unique to GMP biosynthesis [catalytic activity: inosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH].
ProductProbable inosine-5'-monophosphate dehydrogenase GuaB2 (imp dehydrogenase) (inosinic acid dehydrogenase) (inosinate dehydrogenase) (imp oxidoreductase) (inosine-5'-monophosphate oxidoreductase) (IMPDH) (IMPD)
CommentsRv3411c, (MTCY78.17), len: 529 aa. Probable guaB2, inosine-5'-monophosphate (imp) dehydrogenase, equivalent to Q49729|IMDH_MYCLE|GUAB|ML0387|B1620_C3_238 inosine-5'-monophosphate dehydrogenase from Mycobacterium leprae (529 aa), FASTA scores: opt: 3154, E(): 4.4e-165, (92.45% identity in 529 aa overlap). Highly similar to other inosine-5'-monophosphate dehydrogenases e.g. Q9RHZ0|GUAB from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (506 aa), FASTA scores: opt: 2284, E(): 1.5e-117, (67.9% identity in 505 aa overlap); Q9L0I7|SCD63.02 from Streptomyces coelicolor (501 aa), FASTA scores: opt: 2178, E(): 9e-112, (67.2% identity in 491 aa overlap); O67820|IMDH_AQUAE|GUAB|AQ_2023 from Aquifex aeolicus (490 aa), FASTA scores: opt: 1820, E(): 3.2e-92, (58.1% identity in 487 aa overlap); etc. Also similar to Q50716|YY10_MYCTU|Rv3410c|MT3518|MTCY78.18 hypothetical 38.9 KDA protein from Mycobacterium tuberculosis (38.6% identity in 158 aa overlap). Contains PS00487 imp dehydrogenase / GMP reductase signature. Similar to other eukaryotic and prokaryotic IMPDH and to GMP reductase.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany and the Statens Serum Institute (Denmark) (see citations below). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38299303831519-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3411c|guaB2
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR