Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE58
CommentsRv3426, (MTCY78.03c), len: 232 aa. PPE58, Member of the M. tuberculosis PPE family, similar to many e.g. the downstream O06246|Rv3429|MTCY77.01 (178 aa), FASTA scores: opt: 555, E(): 6.5e-26, (72.0% identity in 125 aa overlap); and upstream Q50703|YY25_MYCTU|Rv3425|MTCY78.04c (176 aa), FASTA scores: opt: 517, E(): 1.1e-23, (68.0% identity in 125 aa overlap); MTV049_30, MTCY3C7_24, MTCY428_16, MTCY3A2_22; etc.
Functional categoryPe/ppe
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsDNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38430363843734+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3426|PPE58
MHLMIPAEYISNVIYEGPRADSLYAADQRLRQLADSVRTTAESLNTTLDELHENWKGSSSEWMADAALRYLDWLSKHSRQILRTARVIESLVMAYEETLLRVVPPATIANNREEVRRLIASNVAGGKHSSNRRPRGTIRAVPGRKYPSNGPLSKLDPICAIEAAPMAGAAADPQERVGPRGRRGLAGQQQCRGRPGPSLRCSHDTPRFQMNQAFHTMVNMLLTCFACQEKPR