Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE59
CommentsRv3429, (MTCY77.01), len: 178 aa. PPE59, Member of the M. tuberculosis PPE family, similar to many e.g. the upstream Q50703|YY25_MYCTU|Rv3425|MTCY78.04c (176 aa), FASTA scores: opt: 781, E(): 1.9e-44, (69.9% identity in 176 aa overlap); and Q50702|YY26_MYCTU|Rv3426|MTCY78.03c (232 aa), FASTA scores: opt: 555, E(): 1.7e-29, (72.0% identity in 125 aa overlap) (but diverges at 3' end); etc.
Functional categoryPe/ppe
TranscriptomicsDNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38471653847701+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3429|PPE59
MHPMIPAEYISNIIYEGPGADSLSAAAEQLRLMYNSANMTAKSLTDRLGELQENWKGSSSDLMADAAGRYLDWLTKHSRQILETAYVIDFLAYVYEETRHKVVPPATIANNREEVHRLIASNVAGVNTPAIAGLDAQYQQYRAQNIAVMNDYQSTARFILAYLPRWQEPPQIYGGGGG