Gene Rv3429
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PPE family protein PPE59 |
| Comments | Rv3429, (MTCY77.01), len: 178 aa. PPE59, Member of the M. tuberculosis PPE family, similar to many e.g. the upstream Q50703|YY25_MYCTU|Rv3425|MTCY78.04c (176 aa), FASTA scores: opt: 781, E(): 1.9e-44, (69.9% identity in 176 aa overlap); and Q50702|YY26_MYCTU|Rv3426|MTCY78.03c (232 aa), FASTA scores: opt: 555, E(): 1.7e-29, (72.0% identity in 125 aa overlap) (but diverges at 3' end); etc. |
| Functional category | Pe/ppe |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3847165 | 3847701 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3429|PPE59
MHPMIPAEYISNIIYEGPGADSLSAAAEQLRLMYNSANMTAKSLTDRLGELQENWKGSSSDLMADAAGRYLDWLTKHSRQILETAYVIDFLAYVYEETRHKVVPPATIANNREEVHRLIASNVAGVNTPAIAGLDAQYQQYRAQNIAVMNDYQSTARFILAYLPRWQEPPQIYGGGGG
Bibliography
- Gold B et al. [2001]. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Regulon
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
