Gene Rv3435c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Rv3435c, (MTCY77.07c), len: 284 aa. Probable conserved transmembrane protein, showing some similarity with P95061|Rv0713|MTCY210.32 hypothetical 33.9 KDA protein from Mycobacterium tuberculosis (313 aa), FASTA scores: opt: 557, E(): 1.3e-26, (35.8% identity in 282 aa overlap); and O32991|MLCB2492.12 from Mycobacterium leprae (95 aa), FASTA scores: opt: 150, E(): 0.022, (35.3% identity in 85 aa overlap). Equivalent to AAK47881 from Mycobacterium tuberculosis strain CDC1551 (312 aa) but shorter 28 aa. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3853939 | 3854793 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3435c|Rv3435c
LGRILRVVVGLVLVIAAYVTVIALYHSTGLGRPHEVAHGRPTADGTTVTLHVEQLQTIKGVLVANLAVSPGTELLDSQTQGLKDDLTVTVTSVVTPTKRTWSSGSLPGVFPVPLTISGDPANWPFDHYRSGPITVQLYRGAAHAPERVSVTFVDRLPGWNVDISGVGDANVPAPYRVGLHRSPSSVAFGTVIVGVLIALAGVGLFVAVQTARGRRQFQPPMTTWYAAMLFAVIPLRNALPDAPPIGFWIDVTVVLWVVVALVTSMVLYILCWWWHLKPDVDETM
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant