Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPutative ESAT-6 like protein EsxT
CommentsRv3444c, (MTCY77.16c), len: 100 aa. EsxT, ESAT-6 like protein (see citation below), equivalent to Q9CCV7|ML0363 possible secreted protein from Mycobacterium leprae (104 aa), FASTA scores: opt: 362, E(): 1.1e-18, (71.25% identity in 73 aa overlap). C-terminal part highly similar to Q49852|B229_C1_150 hypothetical 5.3 KDA protein from Mycobacterium leprae (49 aa), FASTA scores: opt: 227, E(): 1.4e-09, (68.9% identity in 45 aa overlap). Seems to belong to the ESAT6 family.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38626243862926-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3444c|esxT
MNADPVLSYNFDAIEYSVRQEIHTTAARFNAALQELRSQIAPLQQLWTREAAAAYHAEQLKWHQAASALNEILIDLGNAVRHGADDVAHADRRAAGAWAR