Gene Mb3474c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | putative esat-6 like protein esxt |
| Comments | Mb3474c, esxT, len: 100 aa. Equivalent to Rv3444c,len: 100 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 100 aa overlap). esxT, conserved hypothetical protein, equivalent to Q9CCV7|ML0363 POSSIBLE SECRETED PROTEIN from Mycobacterium leprae (104 aa), FASTA scores: opt: 362, E(): 1.1e-18, (71.25% identity in 73 aa overlap). C-terminal part highly similar to Q49852|B229_C1_150 HYPOTHETICAL 5.3 KDA PROTEIN from Mycobacterium leprae (49 aa), FASTA scores: opt: 227, E(): 1.4e-09, (68.9% identity in 45 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3810325 | 3810627 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3474c|esxT
MNADPVLSYNFDAIEYSVRQEIHTTAARFNAALQELRSQIAPLQQLWTREAAAAYHAEQLKWHQAASALNEILIDLGNAVRHGADDVAHADRRAAGAWAR
Bibliography
No article yet recorded