Gene Rv3451 (culp3, clp3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin (a polyester that forms the structure of plant cuticle). Shown to have TDM-specific hydrolase activity (see Yang et al. 2014). |
| Product | Probable cutinase precursor Cut3 |
| Comments | Rv3451, (MTCY13E12.04), len: 262 aa. Probable cut3, cutinase precursor, similar to others e.g. Q9KK87 from Mycobacterium avium (220 aa), FASTA scores: opt: 540, E(): 3.5e-24, (43.4% identity in 219 aa overlap); Q00298|CUTI_BOTCI|CUTA from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 214, E(): 2e-05, (31.45% identity in 210 aa overlap); Q9Y7G8 from Pyrenopeziza brassicae (203 aa), FASTA scores: opt: 203, E(): 8.5e-05, (31.05% identity in 190 aa overlap); P29292|CUTI_ASCRA from Ascochyta rabiei (223 aa), FASTA scores: opt: 155, E(): 0.054, (31.65% identity in 120 aa overlap). Similar to other proteins from Mycobacterium tuberculosis e.g. the downstream ORF O06319|Rv3452|MTCY13E12.05 hypothetical 23.1 KDA protein (226 aa), FASTA scores: opt: 775, E(): 1e-37, (58.65% identity in 220 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c probable cutinase precursor (219 aa), FASTA scores: opt: 565, E(): 1.3e-25, (44.85% identity in 223 aa overlap); Q10837|CUT1_MYCTU|Rv1984c|MT2037|MTCY39.35 probable cutinase precursor (217 aa), FASTA scores: opt: 489, E(): 3e-21, (47.05% identity in 221 aa overlap); etc. Equivalent to AAK47897 from Mycobacterium tuberculosis strain CDC1551 (247 aa) but longer 15 aa. Contains cutinase, serine active site motif (PS00155). Belongs to the cutinase family. Alternative start possible at 3733. Start changed since first submission (+15 aa). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). Induced under nutrient-limiting conditions and remodels the Mtb envelope to increase nutrient influx but concomitantly sensitizes Mtb to stresses encountered in the host (see Yang et al. 2014). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). deltaRv3451 mutant is more resilient to stress and grows to levels higher than those of wild-type in immunocompetent mice. By contrast, mutant growth is retarded in MyD88-/- mice (see Yang et al. 2014). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3872617 | 3873405 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3451|cut3
VNNRPIRLLTSGRAGLGAGALITAVVLLIALGAVWTPVAFADGCPDAEVTFARGTGEPPGIGRVGQAFVDSLRQQTGMEIGVYPVNYAASRLQLHGGDGANDAISHIKSMASSCPNTKLVLGGYSQGATVIDIVAGVPLGSISFGSPLPAAYADNVAAVAVFGNPSNRAGGSLSSLSPLFGSKAIDLCNPTDPICHVGPGNEFSGHIDGYIPTYTTQAASFVVQRLRAGSVPHLPGSVPQLPGSVLQMPGTAAPAPESLHGR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM and Britton WJ [2009]. Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification. Function
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Yang Y et al. [2014]. A hydrolase of trehalose dimycolate induces nutrient influx and stress sensitivity to balance intracellular growth of Mycobacterium tuberculosis. Function
- Yang Y et al. [2014]. A hydrolase of trehalose dimycolate induces nutrient influx and stress sensitivity to balance intracellular growth of Mycobacterium tuberculosis. Transcriptome
- Yang Y et al. [2014]. A hydrolase of trehalose dimycolate induces nutrient influx and stress sensitivity to balance intracellular growth of Mycobacterium tuberculosis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant