Gene Rv3452 (culp4, clp4)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin (a polyester that forms the structure of plant cuticle). Shown to have esterase and phospholipase activity. Shown to have TDM-specific hydrolase activity (see Yang et al. 2014). |
| Product | Probable cutinase precursor Cut4 |
| Comments | Rv3452, (MTCY13E12.05), len: 226 aa. Probable cut4, cutinase precursor, similar to other e.g. Q9KK87 from Mycobacterium avium (220 aa), FASTA scores: opt: 522, E(): 7.3e-24, (46.6% identity in 221 aa overlap); P30272|CUTI_MAGGR|CUT1 from Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) (228 aa), FASTA scores: opt: 205, E(): 3.8e-05, (29.25% identity in 164 aa overlap); Q00298|CUTI_BOTCI|CUTA from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 204, E(): 3.9e-05, (33.5% identity in 209 aa overlap); etc. Similar to other proteins from Mycobacterium tuberculosis e.g. upstream ORF O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 probable cutinase precursor (247 aa), FASTA scores: opt: 773, E(): 1.3e-38, (59.35% identity in 209 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c probable cutinase precursor (219 aa), FASTA scores: opt: 704, E(): 1.3e-34, (53.4% identity in 219 aa overlap); etc. Contains PS00155 Cutinase, serine active site. Belongs to the cutinase family. Alternative start possible at 4553 in cSCY13E12 but no RBS. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3873452 | 3874132 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3452|cut4
VIPRPQPHSGRWRAGAARRLTSLVAAAFAAATLLLTPALAPPASAGCPDAEVVFARGTGEPPGLGRVGQAFVSSLRQQTNKSIGTYGVNYPANGDFLAAADGANDASDHIQQMASACRATRLVLGGYSQGAAVIDIVTAAPLPGLGFTQPLPPAADDHIAAIALFGNPSGRAGGLMSALTPQFGSKTINLCNNGDPICSDGNRWRAHLGYVPGMTNQAARFVASRI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM and Britton WJ [2009]. Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification. Function
- Schué M et al. [2010]. Two cutinase-like proteins secreted by Mycobacterium tuberculosis show very different lipolytic activities reflecting their physiological function. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Yang Y et al. [2014]. A hydrolase of trehalose dimycolate induces nutrient influx and stress sensitivity to balance intracellular growth of Mycobacterium tuberculosis. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
