Gene Mb3482
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CUTINASE PRECURSOR CUT4 |
| Comments | Mb3482, cut4, len: 226 aa. Equivalent to Rv3452,len: 226 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 226 aa overlap). Probable cut4,cutinase precursor (EC 3.1.1.-), similar to other e.g. Q9KK87 from Mycobacterium avium (220 aa), FASTA scores: opt: 522, E(): 7.3e-24, (46.6% identity in 221 aa overlap); P30272|CUTI_MAGGR|CUT1 from Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) (228 aa), FASTA scores: opt: 205, E(): 3.8e-05, (29.25% identity in 164 aa overlap); Q00298|CUTI_BOTCI|CUTA from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 204,E(): 3.9e-05, (33.5% identity in 209 aa overlap); etc. Similar to other proteins from Mycobacterium tuberculosis e.g. upstream ORF O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 PROBABLE CUTINASE PRECURSOR (247 aa), FASTA scores: opt: 773, E(): 1.3e-38, (59.35% identity in 209 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c PROBABLE CUTINASE PRECURSOR (219 aa), FASTA scores: opt: 704, E(): 1.3e-34, (53.4% identity in 219 aa overlap); etc. Contains PS00155 Cutinase, serine active site. BELONGS TO THE CUTINASE FAMILY. Alternative start possible at 4553 in cSCY13E12 but no RBS. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3821153 | 3821833 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3482|cut4
MIPRPQPHSGRWRAGAARRLTSLVAAAFAAATLLLTPALAPPASAGCPDAEVVFARGTGEPPGLGRVGQAFVSSLRQQTNKSIGTYGVNYPANGDFLAAADGANDASDHIQQMASACRATRLVLGGYSQGAAVIDIVTAAPLPGLGFTQPLPPAADDHIAAIALFGNPSGRAGGLMSALTPQFGSKTINLCNNGDPICSDGNRWRAHLGYVPGMTNQAARFVASRI
Bibliography
No article yet recorded